top of page

CircRNA

Gene

chr3|47086194|47106120|—|6|circRNA|SETD2|NM_014159|11,10,9,8,7,6

SETD2

Open Reading Frame (ORF)

LKSFLERHGLSLLWIWMAELGDGRESNQKLQEEEHLCPRILWRGTRS

Peptide

LQEEEHLCPRILWR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page