top of page

CircRNA

Gene

chr3|45110472|45112445|-|2|circRNA|CDCP1|NM_022842|4,3

CDCP1

CircRNA UID

circCDCP1(4,3)

Open Reading Frame (ORF)

LSFLHTCGPASPSSTSTSPTVRGRRSGLNTTSRAPPPTPRCSSWRTSSLGTWRGTSTSLCKAVTKMPKVQGSSGCSSKFWSNIHKMKATVCQAHVLLGRFSFSPRHRCCLPSTELSSGMSKLIRASV

Peptide

AVTKMPK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page