top of page

CircRNA

Gene

chr3|45110472|45112445|—|2|circRNA|CDCP1|NM_022842|4,3

CDCP1

Open Reading Frame (ORF)

LSFLHTCGPASPSSTSTSPTVRGRRSGLNTTSRAPPPTPRCSSWRTSSLGTWRGTSTSLCKAVTKMPKVQGSSGCSSKFWSNIHKMKATVCQAHVLLGRFSFSPRHRCCLPSTELSSGMSKLIRASV

Peptide

MPKVQGSSGCSSK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page