top of page

CircRNA

Gene

chr3|43299753|43303792|+|2|circRNA|SNRK|ENST00000454177.5|3,4

SNRK

Open Reading Frame (ORF)

MRRSILNSLNIFSSVGPAWQDLSEGMMERLLDYMIWIKPWVEAILPWLNLPGMSLRVKRWQ

Peptide

LLDYMIWIKPWVEAILPWLNLPGMSLR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page