top of page

CircRNA

Gene

chr3|41681507|41705305|-|4|circRNA|ULK4|NM_017886|29,28,27,26

ULK4

CircRNA UID

circULK4(29,28,27,26)

Open Reading Frame (ORF)

LRLLSETTSLLVNQEFGDGKEKASVDSDSNLLALIRDVLLPQVILNL

Peptide

DVLLPQVILNL

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page