top of page

CircRNA

Gene

chr3|37947056|37975894|+|5|circRNA|CTDSPL|ENST00000443503.6|2,3,4,5,6

CTDSPL

Open Reading Frame (ORF)

LSRLGRELSKVIIVDNSPASYIFHPENAPPSATSA

Peptide

ELSKVIIVDNSPASYIFHPENAPPSATSA

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page