top of page

CircRNA

Gene

chr3|37323587|37329093|+|3|circRNA|GOLGA4|ENST00000361924.6|14,15,16

GOLGA4

Open Reading Frame (ORF)

LRFIDENSMMSYQSGKRNLISKLKNFRKYMKSNYRKKNKR

Peptide

LRFIDENSMMSYQSGK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page