top of page

CircRNA

Gene

chr3|31683633|31879830|-|7|circRNA|OSBPL10|ENST00000396556.6|8,7,6,5,4,3,2

OSBPL10

Open Reading Frame (ORF)

LEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCSWEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYCECEEKRLCVNTHVWTKSKFMGMSVGVSMIGEGTSYWISRLASCSIL

Peptide

SKFMGMSVGVSMIGEGTSYWISR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page