top of page

CircRNA

Gene

chr3|31683633|31733411|-|3|circRNA|OSBPL10|ENST00000396556.6|8,7,6

OSBPL10

CircRNA UID

circOSBPL10(8,7,6)

Open Reading Frame (ORF)

MDQKQVHGHVRGGLYDRGRKHPGMARVQVTFHRAAEKWDTWLFAISQCQHNLGNFTKLC

Peptide

GGLYDRGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page