top of page

CircRNA

Gene

chr3|27403138|27452498|-|13|circRNA|SLC4A7|NM_001258380|14,13,12,11,10,9,8,7,6,5,4,3,2

SLC4A7

CircRNA UID

circSLC4A7(14,13,12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LSLRTSIGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSVLMKKLLWILAKLAQL

Peptide

LLWILAK

ORF Found in Long-Read

true

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page