top of page

CircRNA

Gene

chr3|27385891|27404963|—|10|circRNA|SLC4A7|NM_001258380|22,21,20,19,18,17,16,15,14,13

SLC4A7

Open Reading Frame (ORF)

LCANSWTCVSRRENLVGLMILCQKVRKRKKMTKRKKRKRVQ

Peptide

LCANSWTCVSRR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page