top of page

CircRNA

Gene

chr3|27379248|27452498|-|23|circRNA|SLC4A7|NM_001258379|24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

SLC4A7

CircRNA UID

circSLC4A7(24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

MAKTAQWKALSMNTENAKVTRSNMRVLMKKLLWILAKLAQL

Peptide

SNMRVLMK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page