top of page

CircRNA

Gene

chr3|19950805|19951061|+|1|circRNA|RAB5A|ENST00000273047.8|2

RAB5A

Open Reading Frame (ORF)

LDMASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGGFFTSRKKNIGPLNSGSSLKSLKLGTYFKFGHG

Peptide

GQFHEFQESTIGGFFTSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page