top of page

CircRNA

Gene

chr3|197835673|197848021|+|4|circRNA|LRCH3|NM_032773|9,10,11,12

LRCH3

Open Reading Frame (ORF)

LSHTDLELHQRREQLVERTRREAQLAALQYEEEKIRTKQIQRDAVLDFVKWNMIWIRLTT

Peptide

DAVLDFVKWNMIWIR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page