top of page

CircRNA

Gene

chr3|196806578|196818156|+|7|circRNA|PAK2|ENST00000327134.7|6,7,8,9,10,11,12

PAK2

Open Reading Frame (ORF)

LEFLHANQVIHRDIKSDNVLLGMEGSVKLTECQGNRSTRSSDRGGG

Peptide

SDNVLLGMEGSVKLTECQGNR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page