top of page

CircRNA

Gene

chr3|19450105|19456982|+|3|circRNA|KCNH8|ENST00000328405.6|9,10,11

KCNH8

CircRNA UID

circKCNH8(9,10,11)

Open Reading Frame (ORF)

MLTNSWKTFSMTSHTTSEKVMRVILDARLGVWKRDSNHTEDVLQMVPLSH

Peptide

DSNHTEDVLQMVPLSH

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page