top of page

CircRNA

Gene

chr3|188406111|188609844|+|4|circRNA|LPP|ENST00000448637.5|3,4,5,6

LPP

Open Reading Frame (ORF)

LPLHQDKFMAQGPRAITLSQFLSLGSVHLLQHGEAWIMPTFHHQDFSRSLGMGMPPTRDAIMKATMQQGQAMGAEMTLTLPMVNKVTQIPGNGNQGTLLLEQGTRTLLGCIQSLVPRRPISQILFQPPVRHHCSQRFQQCLTHLGCHPKALVSPSAMCLHGWRPPIPLGTPAFQCLHNSHPKSLPR

Peptide

VTQIPGNGNQGTLLLEQGTR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page