top of page

CircRNA

Gene

chr3|187038741|187051346|+|3|circRNA|ST6GAL1|ENST00000169298.7|3,4,5

ST6GAL1

Open Reading Frame (ORF)

LRFNGAPTANFQQDVGTKTTIRLMNSQMSFDHPEKNGPWPADPINLPSHG

Peptide

LMNSQMSFDHPEK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page