top of page

CircRNA

Gene

chr3|186783639|186784431|+|1|ciRNA|EIF4A2|ENST00000441007.5|2

EIF4A2

Open Reading Frame (ORF)

LEAAVSTRPRRGGDGTGPVPVNRWHRPRQAAPPASITRLAHCWGRSSALRALARRSAVETGSPCARAWGAAFPGIRRPQPLGKAHSVDIRPEAAALACAGEANVLRRVAKGYALKVQLRWPGRGV

Peptide

SSALRALAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page