top of page

CircRNA

Gene

chr3|18415110|18420991|—|4|circRNA|SATB1|ENST00000338745.10|5,4,3,2

SATB1

Open Reading Frame (ORF)

LPQTRRLASRTMVAHHSEECSEGLTERYESEFIGQGVPPFTGDL

Peptide

YESEFIGQGVPPFTGDL

ORF Found in Long-Read

true

Peptide Length

17

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page