top of page

CircRNA

Gene

chr3|183070998|183092545|—|5|circRNA|MCCC1|NR_120640|7,6,5,4,3

MCCC1

Open Reading Frame (ORF)

MRIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRKKHYQGPHCKQRRNCLQGDAHSQKTGCTDCGGL

Peptide

HYQGPHCKQR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page