top of page

CircRNA

Gene

chr3|183033990|183041750|-|3|circRNA|MCCC1|NR_120640|13,12,11

MCCC1

Open Reading Frame (ORF)

LNISYTRNMTLKDGKNNCSRREDSFEPGRNNSAGPCLRS

Peptide

EDSFEPGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page