top of page

CircRNA

Gene

chr3|179740246|179745217|+|3|circRNA|USP13|ENST00000263966.7|11,12,13

USP13

CircRNA UID

circUSP13(11,12,13)

Open Reading Frame (ORF)

LSWYVPRYHLVPAFRPSLNQKMLMISGAVPYKQSLRV

Peptide

MLMISGAVPYK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page