top of page

CircRNA

Gene

chr3|171642839|171674613|—|5|circRNA|PLD1|ENST00000356327.9|22,21,20,19,18

PLD1

Open Reading Frame (ORF)

MCRGENSILGQLKAEHYEIKISVPFLSFSASKVSNNSP

Peptide

ISVPFLSFSASKVSNNSP

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page