top of page

CircRNA

Gene

chr3|17009673|17014911|+|2|circRNA|PLCL2|ENST00000615277.4|2,3

PLCL2

CircRNA UID

circPLCL2(2,3)

Open Reading Frame (ORF)

LSLSSKNCINQRTKLVPRSQRKNLLRFFMSFVLDLKFISF

Peptide

NCINQRTK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page