top of page

CircRNA

Gene

chr3|168032519|168048365|-|7|circRNA|GOLIM4|NM_001308155|8,7,6,5,4,3,2

GOLIM4

Open Reading Frame (ORF)

MMCGRTMKQFLEEQKTQNSMLPPIRRQNFRLPQSQSNKKWNAENLRSIRWKRSTERPWRRKKWSRSGKQNILRRNTIHHQRSRIGSGKSSMSNEKQPTSWKGTRVLSCI

Peptide

SRIGSGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page