top of page

CircRNA

Gene

chr3|161238191|161238729|+|1|ciRNA|NMD3|ENST00000351193.6|8

NMD3

CircRNA UID

ciNMD3(8)

Open Reading Frame (ORF)

LNVTKSKDLGMDADHIYSSGSDNFSLFKIVVEILTQSGSIYWVNHPLTEVVGLVLQRSGNFHSWSLY

Peptide

SKDLGMDADHIYSSGSDNFSLFK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page