top of page

CircRNA

Gene

chr3|161234726|161241163|+|5|circRNA|NMD3|ENST00000351193.6|6,7,8,9,10

NMD3

Open Reading Frame (ORF)

LSPKLAQSLGNMNQICVCIRVTSAIHLIDPNTLQGDEWCYPSTSVCGGLCCSVPNVWRLP

Peptide

GDEWCYPSTSVCGGLCCSVPNVWRLP

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page