top of page

CircRNA

Gene

chr3|15707923|15795306|—|13|circRNA|ANKRD28|ENST00000624145.3|14,13,12,11,10,9,8,7,6,5,4,3,2

ANKRD28

Open Reading Frame (ORF)

LHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGNHHWCKLYLTEILMKFEH

Peptide

LYLTEILMK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page