top of page

CircRNA

Gene

chr3|15685225|15686309|—|3|circRNA|ANKRD28|ENST00000383777.5|19,18,17

ANKRD28

Open Reading Frame (ORF)

MHYFNMVLSAYFGIAGAGRLYTCLLPVDTLVFLEPFCSQQHLWMQIQPQQTIMDIRHFTGLATMQQMVIQNAYGY

Peptide

MHYFNMVLSAYFGIAGAGR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page