top of page

CircRNA

Gene

chr3|152445539|152446588|+|1|ciRNA|MBNL1|ENST00000282486.10|5

MBNL1

Open Reading Frame (ORF)

LTTSYSFSNLFKKIAEDMFVQVSQTIYKEVTFTEVRVTPQMVQIAPTLGLTLNLSYCGCRVSEISAL

Peptide

VSEISAL

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page