top of page

CircRNA

Gene

chr3|149911977|149921227|+|2|circRNA|RNF13|NM_007282|8,9

RNF13

CircRNA UID

circRNF13(8,9)

Open Reading Frame (ORF)

LSRIDIELEETDFVKINLRNFLYINSRKGPPYLSSRI

Peptide

IDIELEETDFVKINLR

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page