top of page

CircRNA

Gene

chr3|142465096|142508109|-|14|circRNA|ATR|NM_001184|41,40,39,38,37,36,35,34,33,32,31,30,29,28

ATR

CircRNA UID

circATR(41,40,39,38,37,36,35,34,33,32,31,30,29,28)

Open Reading Frame (ORF)

MMCKPKDDLRKDCRLMEFNSLINKYLLWIMKTIRV

Peptide

YLLWIMK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page