top of page

CircRNA

Gene

chr3|142453127|142505303|—|18|circRNA|ATR|NM_001184|46,45,44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29

ATR

Open Reading Frame (ORF)

MKLEKLSMKRNCMLLCMNLMEWPESVQLERQNHL

Peptide

LEKLSMK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page