top of page

CircRNA

Gene

chr3|142093060|142101841|-|2|circRNA|TFDP2|ENST00000489671.5|3,2

TFDP2

Open Reading Frame (ORF)

LTSTNAEVRGFIDQNLSPTKGCSFKELLKTKVFFFLFF

Peptide

GFIDQNLSPTKGCSFK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page