top of page

CircRNA

Gene

chr3|138707158|138714719|—|3|circRNA|PIK3CB|NM_006219|9,8,7

PIK3CB

Open Reading Frame (ORF)

LFKQIHILKMQQLCMLNFQRIKNNLIITLPSIRFMSGLVFFMVLSSCVKPS

Peptide

FMSGLVFFMVLSSCVKPS

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page