top of page

CircRNA

Gene

chr3|136980465|136992088|+|4|circRNA|IL20RB|NM_144717|2,3,4,5

IL20RB

Open Reading Frame (ORF)

LGGTAPSARQNVWRCKMKWPFCLPLRTSLYSQPT

Peptide

LGGTAPSARQNVWR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page