top of page

CircRNA

Gene

chr3|136443286|136502779|—|8|circRNA|STAG1|ENST00000383202.6|15,14,13,12,11,10,9,8

STAG1

Open Reading Frame (ORF)

MGELSRTVERLGMYDRVAIRRTCSRRGSHEAHDCSGECCLKPQYSSG

Peptide

LGMYDRVAIR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page