top of page

CircRNA

Gene

chr3|136102006|136106322|+|3|circRNA|PPP2R3A|ENST00000264977.7|11,12,13

PPP2R3A

CircRNA UID

circPPP2R3A(11,12,13)

Open Reading Frame (ORF)

MLRTMGLSPQTGTGLPLRSMRRLLQRNLPKHNSRKALSIGSAAWMWMETVYSPCMSWSTSMRSSVNGWKPWELSPCHSMIYCARCLT

Peptide

KALSIGSAAWMWMETVYSPCMSWSTSMR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

20

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page