top of page

CircRNA

Gene

chr3|133746483|133748411|+|1|ciRNA|TF|ENST00000402696.7|1

TF

CircRNA UID

ciTF(1)

Open Reading Frame (ORF)

LARAFPATRAATAQPACTPRSGWKPGCLGAFPLPLYAPPLAFAWASRHLSLHSLSSPPPPLCPVNLAAVKYNKSEHV

Peptide

AATAQPACTPR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page