top of page

CircRNA

Gene

chr3|133637875|133644363|—|4|circRNA|TOPBP1|ENST00000260810.9|14,13,12,11

TOPBP1

Open Reading Frame (ORF)

MILLTFLCKKKTSLLSVIVSLMFLQLLKKAYLAKRVSLFWVLVMKMNLTSQTS

Peptide

MILLTFLCK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page