top of page

CircRNA

Gene

chr3|132686259|132688891|-|3|circRNA|NPHP3-ACAD11|NR_037804|22,21,20

NPHP3-ACAD11

CircRNA UID

circNPHP3-ACAD11(22,21,20)

Open Reading Frame (ORF)

LIMLGPSMNWVFSTIFKITWSHSTFAEVFRDSRNSFRSRSPKSSPVPPPTSKCIRAVEEVWQCRTTV

Peptide

DSRNSFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page