top of page

CircRNA

Gene

chr3|132618633|132644896|-|10|circRNA|ACAD11|ENST00000496418.5|11,10,9,8,7,6,5,4,3,2

ACAD11

CircRNA UID

circACAD11(11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LLKKQENAFLLQMSLTAKHQSRKVQSNLLSPEGLSNICAQEKTTRFTSS

Peptide

KVQSNLLSPEGLSNICAQEK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page