top of page

CircRNA

Gene

chr3|132525609|132531097|+|4|circRNA|DNAJC13|ENST00000260818.10|52,53,54,55

DNAJC13

CircRNA UID

circDNAJC13(52,53,54,55)

Open Reading Frame (ORF)

LCRSSVWSAFKDQKHDLFISESQTAGYLTGRNSGNLDNGNSVSLQRTTSAGRSGPAIGPSSQSYPGNES

Peptide

NSGNLDNGNSVSLQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page