top of page

CircRNA

Gene

chr3|12935447|12936697|—|1|circRNA|IQSEC1|NM_014869|3

IQSEC1

Open Reading Frame (ORF)

MSPCTSMRRSCRPLCPSRRQGTGRPAPSRTCGYGLGAQPQTTGPWPTKRTRLTRTRAAGARRRWSGRSSGCGWSICRCSPSSHPATALWTLVTARSGGHSRGRVLTSAALAGSRAVPSMVPTAAPPRASPGRSLSCGPGPPGPWTATWPSMAQPTGRASLSRTTQTVTMTASTARPTPTIPSTAAPSHRPVTACGSRRSASRPTTRRPATAGTRLPLATMSSARGTTASA

Peptide

ASPGRSLSCGPGPPGPWTATWPSMAQPTGR

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page