top of page

CircRNA

Gene

chr3|12908348|12941865|—|11|circRNA|IQSEC1|NM_014869|12,11,10,9,8,7,6,5,4,3,2

IQSEC1

Open Reading Frame (ORF)

MSQCSSLKKESGNGTLSRACLDDSYASGEGLKRSALSSSLRDLSEAASRARPPAVRLAHPWTAPQPTPRAPWCPVPA

Peptide

DLSEAASR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page