top of page

CircRNA

Gene

chr3|128945070|128945975|—|1|circRNA|RP11—723O4.6|ENST00000508239.1|3

RP11-723O4.6

Open Reading Frame (ORF)

LGRTLWIHTSTSRPSSLPERQRTTPLSPRTRCGTLMASPRSVLLTSSLATST

Peptide

TLWIHTSTSRPSSLPER

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page