top of page

CircRNA

Gene

chr3|128262127|128264781|+|2|circRNA|EEFSEC|ENST00000254730.10|3,4

EEFSEC

Open Reading Frame (ORF)

LTSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGSISLGDSVEIPALKVPRCTDYTRGGQAGGTRGPRN

Peptide

GGQAGGTRGPR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page