top of page

CircRNA

Gene

chr3|125848229|125848447|-|1|circRNA|RP11-379B18.5|ENST00000622381.4|2

RP11-379B18.5

CircRNA UID

circRP11-379B18.5(2)

Open Reading Frame (ORF)

MGRVALTRDGGEAGPGGHRDKGWHEVPGLDALPG

Peptide

VALTRDGGEAGPGGHR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page