top of page

CircRNA

Gene

chr3|125005264|125021130|-|6|circRNA|HEG1|ENST00000311127.8|9,8,7,6,5,4

HEG1

CircRNA UID

circHEG1(9,8,7,6,5,4)

Open Reading Frame (ORF)

LKVQRSLTTPLASRAPQSVKQRQCMLPPCSLMVARERCDL

Peptide

QCMLPPCSLMVAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page